{"product_id":"proteintech-11822-1-ap","title":"Proteintech, 11822-1-AP, VAMP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe VAMP5 (11822-1-AP) by Proteintech is a Polyclonal antibody targeting VAMP5 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11822-1-AP targets VAMP5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human lung tissue, mouse kidney tissue,  Human peripheral blood leukocyte cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVAMP5, also known as myobrevin, is a member of the vesicle-associated membrane protein (VAMP)\/synaptobrevin family and the SNARE superfamily. Characterized by a common sequence called the SNARE motif, SNARE proteins are involved in membrane fusion and vesicular transport (PMID: 11252968). VAMP5 may participate in trafficking events that are associated with myogenesis, such as myoblast fusion and\/or GLUT4 trafficking.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2390 Product name: Recombinant human VAMP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-116 aa of BC017891 Sequence: MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN Predict reactive species\nFull Name: vesicle-associated membrane protein 5 (myobrevin)\nCalculated Molecular Weight: 12.8 kDa\nObserved Molecular Weight: 13-15 kDa\nGenBank Accession Number: BC017891\nGene Symbol: VAMP5\nGene ID (NCBI): 10791\nRRID: AB_2212965\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95183\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869507834025,"sku":"11822-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11822-1-ap","provider":"Iright","version":"1.0","type":"link"}