{"product_id":"proteintech-11829-1-ap","title":"Proteintech, 11829-1-AP, ARPP-21 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARPP-21 (11829-1-AP) by Proteintech is a Polyclonal antibody targeting ARPP-21 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n11829-1-AP targets ARPP-21 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MOLT-4 cells, mouse brain tissue\nPositive IHC detected in: mouse brain tissue, human cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARPP-21 is a neuron-enriched signaling protein that was first purified and characterized from dopamine-rich regions of the mammalian brain, particularly the bovine caudate nucleus. It exists as two isoforms, ARPP-21A and ARPP-21B, generated by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2399 Product name: Recombinant human ARPP-21 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC017805 Sequence: MSEQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQTL Predict reactive species\nFull Name: cyclic AMP-regulated phosphoprotein, 21 kD\nCalculated Molecular Weight: 89 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC017805\nGene Symbol: ARPP-21\nGene ID (NCBI): 10777\nRRID: AB_2877798\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBL0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869516026025,"sku":"11829-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11829-1-ap","provider":"Iright","version":"1.0","type":"link"}