{"product_id":"proteintech-11830-1-ap","title":"Proteintech, 11830-1-AP, FBXO6 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FBXO6 (11830-1-AP) by Proteintech is a Polyclonal antibody targeting FBXO6 in IHC, ELISA applications with reactivity to human, mouse samples\n11830-1-AP targets FBXO6 in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFBXO6(F-box only protein 6 ) is also named as FBG2, FBS2, FBX6 and belongs to the F-box protein family. It can regulate Chk1 ubiquitination and degradation in both normally cycling cells and during replication stress. This protein is mainly detected in the cytoplasm in both cultured cells and in tumor tissues. Its expression is a predictive biomarker of tumor responsiveness to the important anticancer drugs.(PMID:19716789). FBXO6 can inhibit the anaphase promoting complex (cyclosome APC) and prevent mitotic exit in cytostatic factor (CSF) arrested eggs as a mitotic regulator. The observed molecular size of FBXO6 is around 40 kda, which might be due to the ubiquitination modification of FBXO6.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2400 Product name: Recombinant human FBXO6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-293 aa of BC020880 Sequence: MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLREGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAHGTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCTYQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQYWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF Predict reactive species\nFull Name: F-box protein 6\nCalculated Molecular Weight: 293 aa, 34 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: BC020880\nGene Symbol: FBXO6\nGene ID (NCBI): 26270\nRRID: AB_2104709\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRD1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869682684073,"sku":"11830-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11830-1-ap","provider":"Iright","version":"1.0","type":"link"}