{"product_id":"proteintech-11844-1-ap","title":"Proteintech, 11844-1-AP, UBE2E2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE2E2 (11844-1-AP) by Proteintech is a Polyclonal antibody targeting UBE2E2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n11844-1-AP targets UBE2E2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human thyroid gland tissue,  human brain tissue,  mouse embryo tissue\nPositive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBE2E2(ubiquitin-conjugating enzyme E2 E2) is also named as UBCH8 and belongs to the ubiquitin-conjugating enzyme family. This gene encodes a 22 kDa protein that functions as a major ISG15 E2 enzyme raises the possibility that ISG15 conjugation might use UbcH8-competent Ub E3 enzymes and also function as an E2 for several Ub E3 enzymes, including both HECT E3s and RING E3s(PMID: 15131269).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2509 Product name: Recombinant human UBE2E2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC022332 Sequence: MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2E 2 (UBC4\/5 homolog, yeast)\nCalculated Molecular Weight: 201 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC022332\nGene Symbol: UBE2E2\nGene ID (NCBI): 7325\nRRID: AB_2210274\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96LR5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869438922921,"sku":"11844-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11844-1-ap","provider":"Iright","version":"1.0","type":"link"}