{"product_id":"proteintech-11860-1-ap","title":"Proteintech, 11860-1-AP, DLEU1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DLEU1 (11860-1-AP) by Proteintech is a Polyclonal antibody targeting DLEU1 in WB, IHC, ELISA applications with reactivity to human samples\n11860-1-AP targets DLEU1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, A549 cells\nPositive IHC detected in: human colon cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2435 Product name: Recombinant human DLEU1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC020692 Sequence: MRPCIWIHVHLKPPCRLVELLPFSSALQGLSHLSLGTTLPVILPERNEEQNLQELSHNADKYQMGDCCKEEIDDSIFY Predict reactive species\nFull Name: deleted in lymphocytic leukemia 1 (non-protein coding)\nCalculated Molecular Weight: 78 aa, 9 kDa\nObserved Molecular Weight: 27-30 kDa\nGenBank Accession Number: BC020692\nGene Symbol: DLEU1\nGene ID (NCBI): 10301\nRRID: AB_874117\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43261\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869674852521,"sku":"11860-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11860-1-ap","provider":"Iright","version":"1.0","type":"link"}