{"product_id":"proteintech-11864-1-ap","title":"Proteintech, 11864-1-AP, MS4A7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MS4A7 (11864-1-AP) by Proteintech is a Polyclonal antibody targeting MS4A7 in WB, ELISA applications with reactivity to human, mouse samples\n11864-1-AP targets MS4A7 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BV-2 cells, K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe human MS4A family currently includes 18 members, and these proteins have four putative transmembrane domains (tetraspan) and several protein kinase C (PKC) phosphorylation sites. Membrane-spanning 4-domains a7 (MS4A7)  is a member of the MS4A family. It is expressed by myeloid cells. MS4A7 can act as a NAM-specific pathogenic factor that exacerbates metabolic dysfunction-associated steatohepatitis (MASH) progression in mice (PMID: 38478630). There are two isoforms of MS4A7 protein, with molecular weights of 26.14 kDa and 21.41 kDa respectively.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2442 Product name: Recombinant human MS4A7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-240 aa of BC020673 Sequence: MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHFNPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQDHIQQVKKSSSRSWI Predict reactive species\nFull Name: membrane-spanning 4-domains, subfamily A, member 7\nCalculated Molecular Weight: 240 aa, 26 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC020673\nGene Symbol: MS4A7\nGene ID (NCBI): 58475\nRRID: AB_2144674\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZW8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887725629609,"sku":"11864-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11864-1-ap","provider":"Iright","version":"1.0","type":"link"}