{"product_id":"proteintech-11884-1-ap","title":"Proteintech, 11884-1-AP, GNGT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNGT1 (11884-1-AP) by Proteintech is a Polyclonal antibody targeting GNGT1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n11884-1-AP targets GNGT1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nG protein subunit gamma-T1(GNGT1) is encoded by the transducin gamma-subunit gene, which localized on huaman chromosome 7q21.3, participating in various transmembrane signaling systems. Particularly, GNGT1 gene is specific to retinal rod photoreceptors. Present polyclonal anti-GNGT1 antibody (11884-1-AP) is produced by immunizing rabbits with full-length chain of GNGT1 and  dectects an 8 kDa band in mouse retinal tissue.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2488 Product name: Recombinant human GNGT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-74 aa of BC029367 Sequence: MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEVRDYVEERSGEDPLVKGIPEDKNPFKELKGGCVIS Predict reactive species\nFull Name: guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 1\nCalculated Molecular Weight: 74 aa, 8 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC029367\nGene Symbol: GNGT1\nGene ID (NCBI): 2792\nRRID: AB_10858628\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P63211\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887654064297,"sku":"11884-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11884-1-ap","provider":"Iright","version":"1.0","type":"link"}