{"product_id":"proteintech-11925-1-ap","title":"Proteintech, 11925-1-AP, AP3M2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP3M2 (11925-1-AP) by Proteintech is a Polyclonal antibody targeting AP3M2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11925-1-AP targets AP3M2 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue, Hacat cells (siRNA)\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP3M2 is a 47-kDa protein that belongs to the adaptor complexes medium subunit family. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP3M2 is a subunit of the AP-3 complex which is associated with the Golgi region as well as more peripheral structures. AP-3 is implicated in the transport of lysosomal membrane proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2572 Product name: Recombinant human AP3M2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC056257 Sequence: MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDGNFRLLSYHVSAQKCCLGM Predict reactive species\nFull Name: adaptor-related protein complex 3, mu 2 subunit\nCalculated Molecular Weight: 418 aa, 47 kDa\nObserved Molecular Weight: 47 kDa\nGenBank Accession Number: BC056257\nGene Symbol: AP3M2\nGene ID (NCBI): 10947\nRRID: AB_10640438\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P53677\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46884971315369,"sku":"11925-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11925-1-ap","provider":"Iright","version":"1.0","type":"link"}