{"product_id":"proteintech-11942-1-ap","title":"Proteintech, 11942-1-AP, PKIB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PKIB (11942-1-AP) by Proteintech is a Polyclonal antibody targeting PKIB in IHC, ELISA applications with reactivity to human, mouse samples\n11942-1-AP targets PKIB in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human stomach cancer tissue, human gliomas tissue,  mouse kidney tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cAMP-dependent protein kinase inhibitor-β (PKIB) is also named as PRKACN2. PKIB is presumed to be one of the regulatory factors controlling the cAMP-dependent protein kinase A signaling pathway (PMID: 23224602). PKIB plays an important role in regulating the proliferation, migration, and even metastasis of osteosarcoma (PMID: 17195088). The expression of PKIB in the cytoplasm of tumor is closely related to pAkt and the triple negative breast cancer (PMID: 28387904).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2541 Product name: Recombinant human PKIB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC036011 Sequence: MRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK Predict reactive species\nFull Name: protein kinase (cAMP-dependent, catalytic) inhibitor beta\nCalculated Molecular Weight: 78 aa, 9 kDa\nGenBank Accession Number: BC036011\nGene Symbol: PKIB\nGene ID (NCBI): 5570\nRRID: AB_3085384\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9C010\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887763443881,"sku":"11942-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11942-1-ap","provider":"Iright","version":"1.0","type":"link"}