{"product_id":"proteintech-11972-2-ap","title":"Proteintech, 11972-2-AP, TIPIN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIPIN (11972-2-AP) by Proteintech is a Polyclonal antibody targeting TIPIN in WB, ELISA applications with reactivity to human, mouse, rat samples\n11972-2-AP targets TIPIN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTIPIN, also named as TIMELESS-interacting protein, is a 301 amino acid protein, which belongs to the CSM3 family. TIPIN Plays an important role in the control of DNA replication and the maintenance of replication fork stability. TIPIN forms a complex with TIMELESS and this complex regulates DNA replication processes under both normal and stress conditions, stabilizes replication forks and influences both CHEK1 phosphorylation and the intra-S phase checkpoint in response to genotoxic stress. The calculated molecular weight of TIPIN is 34 kDa, but the result of WB is 55-60 kDa, which is similar to the result of publication.(PMID: 24830473)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2595 Product name: Recombinant human TIPIN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-301 aa of BC000870 Sequence: MLEPQENGVIDLPDYEHVEDETFPPFPPPASPERQDGEGTEPDEESGNGAPVPVPPKRTVKRNIPKLDAQRLISERGLPALRHVFDKAKFKGKGHEAEDLKMLIRHMEHWAHRLFPKLQFEDFIDRVEYLGSKKEVQTCLKRIRLDLPILHEDFVSNNDEVAENNEHDVTSTELDPFLTNLSESEMFASELSRSLTEEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIANTLNEEETLLDQSFKNVQQQLDATSRNITEAR Predict reactive species\nFull Name: TIMELESS interacting protein\nCalculated Molecular Weight: 301 aa, 34 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC000870\nGene Symbol: TIPIN\nGene ID (NCBI): 54962\nRRID: AB_2205116\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BVW5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869616787625,"sku":"11972-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11972-2-ap","provider":"Iright","version":"1.0","type":"link"}