{"product_id":"proteintech-11973-1-ap","title":"Proteintech, 11973-1-AP, TIMM13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIMM13 (11973-1-AP) by Proteintech is a Polyclonal antibody targeting TIMM13 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n11973-1-AP targets TIMM13 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTIMM13 gene, also known as TIM13, TIM13B, TIM M13A or TIMM13B, encodes mitochondrial import inner membrane translocase subunit Tim13 belonging to the small Tim family. TIM13 functions as mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Proteins of the intermembrane space (IMS) of mitochondria are typically synthesized without presequences. TIM13 contains four conserved cysteine residues that bind a zinc ion as cofactor. Import of TIM13 did not depend on the membrane potential or ATP hydrolysis. Upon import into mitochondria TIM13 adopted a stably folded conformation in the IMS.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2596 Product name: Recombinant human TIMM13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-95 aa of BC008607 Sequence: MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCMDRYMDAWNTVSRAYNSRLQRERANM Predict reactive species\nFull Name: translocase of inner mitochondrial membrane 13 homolog (yeast)\nCalculated Molecular Weight: 95 aa, 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC008607\nGene Symbol: TIMM13\nGene ID (NCBI): 26517\nRRID: AB_2287228\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5L4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868961525929,"sku":"11973-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11973-1-ap","provider":"Iright","version":"1.0","type":"link"}