{"product_id":"proteintech-11974-1-ap","title":"Proteintech, 11974-1-AP, FICD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FICD (11974-1-AP) by Proteintech is a Polyclonal antibody targeting FICD in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n11974-1-AP targets FICD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells,  Jurkat cells\nPositive IHC detected in: human small intestine tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAdenosine monophosphate-protein transferase FICD, also named as HIP13 or HYPE, is a 458 amino acid protein, which contains one fido domain and two TPR repeats. FICD localizes in the membrane and belongs to the fic family. FICD as an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. The fido domain mediates the adenylyltransferase activity\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2597 Product name: Recombinant human FICD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-458 aa of BC001342 Sequence: ADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIIDSKVKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISDVLEIHRRVLGYVDPVEAGRFRTTQVLVGHHIPPHPQDVEKQMQEFVQWLNSEEAMNLHPVEFAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYYHVLEAANEGDVRPFIRFIAKCTETTLDTLLFATTEYSVALPEAQPNHSGFKETLPVKP Predict reactive species\nFull Name: FIC domain containing\nCalculated Molecular Weight: 458 aa, 52 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC001342\nGene Symbol: FICD\nGene ID (NCBI): 11153\nRRID: AB_2877811\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BVA6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887640596649,"sku":"11974-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11974-1-ap","provider":"Iright","version":"1.0","type":"link"}