{"product_id":"proteintech-11985-1-ap","title":"Proteintech, 11985-1-AP, DCD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DCD (11985-1-AP) by Proteintech is a Polyclonal antibody targeting DCD in IHC, ELISA applications with reactivity to human samples\n11985-1-AP targets DCD in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human skin tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDermcidin, also named as DCD, AIDD and DSEP, is human antibiotic peptide secreted by sweat glands. It displays antimicrobial activity thereby limiting skin infection by potential pathogens in the first few hours after bacterial colonization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2613 Product name: Recombinant human DCD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC062682 Sequence: MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL Predict reactive species\nFull Name: dermcidin\nCalculated Molecular Weight: 11 kDa\nGenBank Accession Number: BC062682\nGene Symbol: DCD\nGene ID (NCBI): 117159\nRRID: AB_2877812\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P81605\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887070990505,"sku":"11985-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-11985-1-ap","provider":"Iright","version":"1.0","type":"link"}