{"product_id":"proteintech-12000-1-ap","title":"Proteintech, 12000-1-AP, CCL5\/RANTES Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCL5\/RANTES (12000-1-AP) by Proteintech is a Polyclonal antibody targeting CCL5\/RANTES in WB, ELISA applications with reactivity to human samples\n12000-1-AP targets CCL5\/RANTES in WB, IHC, IF, Neutralization, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human peripheral blood platelets, PMA,  LPS and Brefeldin A treated THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRANTES (CCL5) belongs to the CC chemokine family and induces leukocyte migration by binding to specific receptors in the G protein-coupled receptor family. RANTES (CCL5) has been shown in vitro to mediate eosinophil, lymphocyte, neutrophil, and monocyte chemotaxis, and it initiates several other proinflammatory events, such as integrin activation, lipid mediator biosynthesis, and degranulation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2617 Product name: Recombinant human CCL5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-91 aa of BC008600 Sequence: MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS Predict reactive species\nFull Name: chemokine (C-C motif) ligand 5\nCalculated Molecular Weight: 91 aa, 10 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC008600\nGene Symbol: CCL5\/RANTES\nGene ID (NCBI): 6352\nRRID: AB_2877815\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13501\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868893040809,"sku":"12000-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12000-1-ap","provider":"Iright","version":"1.0","type":"link"}