{"product_id":"proteintech-12016-1-ap","title":"Proteintech, 12016-1-AP, IKZF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IKZF1 (12016-1-AP) by Proteintech is a Polyclonal antibody targeting IKZF1 in WB, IHC, IP, ELISA applications with reactivity to human samples\n12016-1-AP targets IKZF1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIKZF1, also known as DNA-binding protein Ikaros, Belongs to the Ikaros C2H2-type zinc-finger protein family. The N-terminal zinc-fingers 2 and 3 are required for DNA binding as well as for targeting IKFZ1 to pericentromeric heterochromatin. The C-terminal zinc-finger domain is required for dimerization. IKZF is abundantly expressed in thymus, spleen and peripheral blood Leukocytes and lymph nodes. IKZF1 is localized in nucleus. IKZF1 as a transcription regulator of hematopoietic cell differentiation binds gamma-satellite DNA and plays a role in the development of lymphocytes, B- and T-cells. Binds and activates the enhancer (delta-A element) of the CD3-delta gene. IKZF1 is a repressor of the TDT (fikzfterminal deoxynucleotidyltransferase) gene during thymocyte differentiation. IKZF1 exists some isofroms with 50-70 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2631 Product name: Recombinant human IKZF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-303 aa of BC018349 Sequence: MDADEGQDMSQVSGKESPPVSDTPDEGDEPMPIPEDLSTTSGGQQSSKSDRVVASNVKVETQSDEENGRACEMNGEECAEDLRMLDASGEKMNGSHRDQGSSALSGVGGIRLPNGKLKCDICGIICIGPNVLMVHKRSHTGERPFQCNQCGASFTQKGNLLRHIKLHSGEKPFKCHLCNYACRRRDALTGHLRTHSVIKEETNHSEMAEDLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEKENEMMKSHVMDQAINNAINYLGAESLRPLVQTPPGGSEVVPVIS Predict reactive species\nFull Name: IKAROS family zinc finger 1 (Ikaros)\nCalculated Molecular Weight: 477 aa, 53 kDa\nObserved Molecular Weight: 50-70 kDa\nGenBank Accession Number: BC018349\nGene Symbol: IKZF1\nGene ID (NCBI): 10320\nRRID: AB_2124704\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13422\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868955955369,"sku":"12016-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12016-1-ap","provider":"Iright","version":"1.0","type":"link"}