{"product_id":"proteintech-12020-1-ap","title":"Proteintech, 12020-1-AP, SPATA7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPATA7 (12020-1-AP) by Proteintech is a Polyclonal antibody targeting SPATA7 in WB, IP, ELISA applications with reactivity to human,  mouse, rat samples\n12020-1-AP targets SPATA7 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, mouse testis tissue,  rat testis tissue\nPositive IP detected in: mouse testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPATA7, also named as HSD3, may be involved in retinal function. It is interesting to note that mutations in SPATA7 cause LCA and RP\/ARRP , two overlapping but distinct human retinal diseases. SPATA7 is another LCA and Juvenile RP Gene.(PMID:19268277) It is a highly conserved, vertebrate-specific protein which expressed in the mature retina. For some modification, the MW always migrate 5-8kd. The antibody can reoginze all the 3 isoforms of SPATA7.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2649 Product name: Recombinant human SPATA7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-468 aa of BC008656 Sequence: SFLSQYRYYTPAKRKKDFTDQRIEAETQTELSFKSELGTAETKNMTDSEMNIKQASNCVTYDAKEKIAPLPLEGHDSTWDEIKDDALQHSSPRAMCQYSLKPPSTRKIYSDEEELLYLSFIEDVTDEILKLGLFSNRFLERLFERHIKQNKHLEEEKMRHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGVIIQQVNDETNLETSTLDENHPSISDSLTDRETSVNVIEGDSDPEKVEISNGLCGLNTSPSQSVQFSSVKGDNNHDMELSTLKIMEMSIEDCPLDV Predict reactive species\nFull Name: spermatogenesis associated 7\nCalculated Molecular Weight: 599 aa, 68 kDa\nObserved Molecular Weight: 68-80 kDa\nGenBank Accession Number: BC008656\nGene Symbol: SPATA7\nGene ID (NCBI): 55812\nRRID: AB_2195380\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9P0W8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869432008873,"sku":"12020-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12020-1-ap","provider":"Iright","version":"1.0","type":"link"}