{"product_id":"proteintech-12062-1-ap","title":"Proteintech, 12062-1-AP, MLLT11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MLLT11 (12062-1-AP) by Proteintech is a Polyclonal antibody targeting MLLT11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12062-1-AP targets MLLT11 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, MOLT-4 cells,  SK-N-SH cells\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMixed-lineage leukemia translocated to 11 (MLLT11), also named ALL1-fused gene from the chromosome 1q (AF1q), which is located in chromosome l band 1q21, has been found to be overexpressed in ovarian cancer and to be associated with a poor patient outcome (PMID: 28423573). It is reported that MLLT11 is a pan-neuronal marker, suggesting a role in neural differentiation in the central nervous system and neural crest-cell derived peripheral ganglia (PMID: 24839873).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2699 Product name: Recombinant human MLLT11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC009624 Sequence: MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL Predict reactive species\nFull Name: myeloid\/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila); translocated to, 11\nCalculated Molecular Weight: 90 aa, 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC009624\nGene Symbol: MLLT11\nGene ID (NCBI): 10962\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13015\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887720583337,"sku":"12062-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12062-1-ap","provider":"Iright","version":"1.0","type":"link"}