{"product_id":"proteintech-12066-1-ap","title":"Proteintech, 12066-1-AP, OTUB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OTUB2 (12066-1-AP) by Proteintech is a Polyclonal antibody targeting OTUB2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12066-1-AP targets OTUB2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOTUB2, also known as C14orf137, belongs to the OTU family. OTUB2 is a functional cysteine protease with deubiquitinase activity. OTUB2 mediates the deubiquitination of substrate proteins, and the targets of substrate proteins can be diversified. Therefore, OTUB2 has a wide range of biological roles, including protecting against virus-induced activation of interferon regulatory factor 3 (IRF3) and NF-κB, promoting beta cell survival in human pancreatic islets, and supporting the DNA repair pathway (PMID: 30662561, 35309903). OTUB2 is widely expressed, with high expression levels in the brain. OTUB2 has 2 isoforms with molecular weights of 9 kDa and 27 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2703 Product name: Recombinant human OTUB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC009615 Sequence: MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFK Predict reactive species\nFull Name: OTU domain, ubiquitin aldehyde binding 2\nCalculated Molecular Weight: 234 aa, 27 kDa\nObserved Molecular Weight: 27 kDa\nGenBank Accession Number: BC009615\nGene Symbol: OTUB2\nGene ID (NCBI): 78990\nRRID: AB_3085388\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96DC9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869479096489,"sku":"12066-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12066-1-ap","provider":"Iright","version":"1.0","type":"link"}