{"product_id":"proteintech-12074-1-ap","title":"Proteintech, 12074-1-AP, TRAPPC4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRAPPC4 (12074-1-AP) by Proteintech is a Polyclonal antibody targeting TRAPPC4 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12074-1-AP targets TRAPPC4 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, MCF-7 cells,  mouse testis tissue,  rat testis tissue\nPositive IP detected in: HL-60 cells\nPositive IHC detected in: human colon cancer tissue, mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransport protein particle (TRAPP, also known as trafficking protein particle), a multimeric guanine nucleotide-exchange factor, regulates multiple membrane trafficking pathways (PMID: 20966969). TRAPPC4, also known as synbindin, is a core component of the TRAPP complexes and one of the essential subunits for guanine nucleotide exchange factor activity for Rab1 GTPase (PMID: 31794024). Deficiencies in vesicular transport mediated by TRAPPC4 have been associated with severe syndromic intellectual disability (PMID: 31794024).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2737 Product name: Recombinant human TRAPPC4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC010866 Sequence: MAIFSVYVVNKAGGLIYQLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGMDVNGRYTADGKEVLEYLGNPANYPVSIRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCYQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFDQNLKLALEVAEKAGTFGPGS Predict reactive species\nFull Name: trafficking protein particle complex 4\nCalculated Molecular Weight: 219 aa, 24 kDa\nObserved Molecular Weight: 24-27 kDa\nGenBank Accession Number: BC010866\nGene Symbol: TRAPPC4\nGene ID (NCBI): 51399\nRRID: AB_2208147\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y296\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887837466793,"sku":"12074-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12074-1-ap","provider":"Iright","version":"1.0","type":"link"}