{"product_id":"proteintech-12086-1-ap","title":"Proteintech, 12086-1-AP, SLC25A10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC25A10 (12086-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A10 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12086-1-AP targets SLC25A10 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, A549 cells,  mouse liver tissue,  mouse kidney tissue,  HepG2 cells,  PC-3 cells\nPositive IP detected in: mouse liver tissue\nPositive IHC detected in: human lung tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC25A10, also known as dicarboxylate ion carrier (DIC), is a mitochondrial inner membrane carrier protein which catalyzes the transport of dicarboxylates such as malate and succinate across the mitochondrial membrane in exchange for phosphate, sulfate, and thiosulfate. SLC25A10 is expressed at highest levels in kidney and liver, lower levels in lung, spleen, heart, and brain, and lowest levels in skeletal muscle. Two isoforms of SLC25A10 exist due to the alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2719 Product name: Recombinant human SLC25A10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-296 aa of BC015797 Sequence: MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAAAGDEPPPQGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS Predict reactive species\nFull Name: solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter), member 10\nCalculated Molecular Weight: 296 aa, 32 kDa\nObserved Molecular Weight: 29-31 kDa\nGenBank Accession Number: BC015797\nGene Symbol: SLC25A10\nGene ID (NCBI): 1468\nRRID: AB_10859816\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UBX3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868988952745,"sku":"12086-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12086-1-ap","provider":"Iright","version":"1.0","type":"link"}