{"product_id":"proteintech-12105-1-ap","title":"Proteintech, 12105-1-AP, SPIN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SPIN1 (12105-1-AP) by Proteintech is a Polyclonal antibody targeting SPIN1 in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12105-1-AP targets SPIN1 in WB, IHC, IF\/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, PC-3 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSPIN1 (Spindlin 1) is a histone methylation reader, which recognizes trimethylated histone H3 lysine 4 through the protein-protein interaction. SPIN1 was initially found in ovarian cancer via searching ovarian cancer-related genes . It is overexpressed in ovarian cancer tissue, which exhibits a high homology to mouse Spin (Spindlin) gene. Signaling pathways responsible for SPIN1 functions include PI3K\/Akt, Wnt and RET that are highly relevant to tumorigenesis.(PMID: 34492335, PMID: 31790762)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2750 Product name: Recombinant human SPIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-262 aa of BC013571 Sequence: MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS Predict reactive species\nFull Name: spindlin 1\nCalculated Molecular Weight: 262 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC013571\nGene Symbol: SPIN1\nGene ID (NCBI): 10927\nRRID: AB_2196111\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y657\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868904083625,"sku":"12105-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12105-1-ap","provider":"Iright","version":"1.0","type":"link"}