{"product_id":"proteintech-12106-1-ap","title":"Proteintech, 12106-1-AP, PTMS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTMS (12106-1-AP) by Proteintech is a Polyclonal antibody targeting PTMS in WB, IF\/ICC, ELISA applications with reactivity to human samples\n12106-1-AP targets PTMS in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTMS, also named as Parathymosin, is a small nuclear protein that can physically interact with glucocorticoid receptors (GR) and histone H1, respectively, and can serve as a coactivator of GR (PMID: 16150697; PMID: 15716277). It is widely distributed in mammalian tissues. Catalog#12106-1-AP is a rabbit polyclonal antibody raised against the full-length of human PTMS. The MW of this protein is 12 kDa, and this antibody specially recognises the 12 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2751 Product name: Recombinant human PTMS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC017025 Sequence: MSEKSVEAAAELSAKDLKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALKRAAEEEDEADPKRQKTENGASA Predict reactive species\nFull Name: parathymosin\nCalculated Molecular Weight: 12 kDa\nObserved Molecular Weight: 10-12 kDa\nGenBank Accession Number: BC017025\nGene Symbol: PTMS\nGene ID (NCBI): 5763\nRRID: AB_10665368\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P20962\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869746450601,"sku":"12106-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12106-1-ap","provider":"Iright","version":"1.0","type":"link"}