{"product_id":"proteintech-12109-1-ap","title":"Proteintech, 12109-1-AP, PTPN9 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PTPN9 (12109-1-AP) by Proteintech is a Polyclonal antibody targeting PTPN9 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n12109-1-AP targets PTPN9 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Transfected HEK-293 cells,  mouse liver tissue,  mouse pancreas tissue\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPTPN9, Tyrosine-protein phosphatase non-receptor type 9, is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. PTPN9 is involved in the transfer of hydrophobic ligands or in functions of the Golgi apparatus (PMID: 19167335). MiR-96 inhibits PTPN9 expression and consequently promotes proliferation, migration and invasion of breast cancer cells (PMID:27857177). PTPN9 can be detected double bands (PMID: 22394684). PTPN9 was located in cytoplasm and nucleus in human breast cancer (PMID: 23418360).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2754 Product name: Recombinant human PTPN9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 248-593 aa of BC010863 Sequence: FQFLPQVNGHPDPFDEIILFSLPPALDWDSVHVPGPHAMTIQELVDYVNARQKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMDGYKQKNAYIGTQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGFLTVTNLGVENMNHYKKTTLEIHNTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSAGIGRTGTFCSLDICLAQLEELGTLNVFQTVSRMRTQRAFSIQTPEQYYFCYKAILEFAEKEGMVSSGQNLLAVESQ Predict reactive species\nFull Name: protein tyrosine phosphatase, non-receptor type 9\nCalculated Molecular Weight: 593 aa, 68 kDa\nObserved Molecular Weight: 68-70 kDa\nGenBank Accession Number: BC010863\nGene Symbol: PTPN9\nGene ID (NCBI): 5780\nRRID: AB_2877826\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P43378\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869578481833,"sku":"12109-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12109-1-ap","provider":"Iright","version":"1.0","type":"link"}