{"product_id":"proteintech-12118-1-ap","title":"Proteintech, 12118-1-AP, ETS1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ETS1 (12118-1-AP) by Proteintech is a Polyclonal antibody targeting ETS1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12118-1-AP targets ETS1 in WB, IHC, IF\/ICC, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse thymus tissue,  Raji cells\nPositive IHC detected in: rat spleen tissue, mouse spleen tissue,  rat lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nETS1 is a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA\/T in target genes. ETS1 is a nuclear protein and primarily acts as a transcriptional activator, though it can also repress gene transcription. Since it is primarily expressed in lymphocytes, it plays several critical roles in immunity. In addition, it is important for angiogenesis. Since cells express several Ets proteins at the same time, functional redundancy is possible. This is particularly shown for the socalled housekeeping genes where several Ets factors were found to occupy the proximal promoters in vivo. The ETS1 protein exists as three isoforms: ETS1-p51, ETS1-p42, ETS1-p27 ranging in size from 27 to 51 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2127 Product name: Recombinant human ETS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-272 aa of BC017314 Sequence: MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT Predict reactive species\nFull Name: v-ets erythroblastosis virus E26 oncogene homolog 1 (avian)\nCalculated Molecular Weight: 441 aa, 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC017314\nGene Symbol: ETS1\nGene ID (NCBI): 2113\nRRID: AB_10664925\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14921\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868884488361,"sku":"12118-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12118-1-ap","provider":"Iright","version":"1.0","type":"link"}