{"product_id":"proteintech-12128-1-ap","title":"Proteintech, 12128-1-AP, SYTL4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SYTL4 (12128-1-AP) by Proteintech is a Polyclonal antibody targeting SYTL4 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n12128-1-AP targets SYTL4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse pancreas tissue,  U2OS cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSYTL4, also known as SLP4 or granuphilin, is a member of the synaptotagmin-like protein (Slp) family. Members of this family are characterized by presence of an N-terminal Slp homology domain (SHD), which functions as a Rab27-binding domain, and C-terminal tandem C2 domains, putative Ca(2+)-binding motifs. SYTL4 is specifically expressed on dense-core granules in certain neuroendocrine cells and negatively controls dense-core vesicle exocytosis through specific interaction with Rab27A. (PMID: 16481396; 16473610)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat, hamster\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2772 Product name: Recombinant human SYTL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 338-671 aa of BC014913 Sequence: IGSMMSIYSEAGDFGNIFVTGRIAFSLKYEQQTQSLVVHVKECHQLAYADEAKKRSNPYVKTYLLPDKSRQGKRKTSIKRDTVNPLYDETLRYEIPESLLAQRTLQFSVWHHGRFGRNTFLGEAEIQMDSWKLDKKLDHCLPLHGKISAESPTGLPSHKGELVVSLKYIPASKTPVGGDRKKSKGGEGGELQVWIKEAKNLTAAKAGGTSDSFVKGYLLPMRNKASKRKTPVMKKTLNPHYNHTFVYNGVRLEDLQHMCLELTVWDREPLASNDFLGGVRLGVGTGISNGEVVDWMDSTGEEVSLWQKMRQYPGSWAEGTLQLRSSMAKQKLGL Predict reactive species\nFull Name: synaptotagmin-like 4\nCalculated Molecular Weight: 671 aa, 76 kDa\nObserved Molecular Weight: 76 kDa\nGenBank Accession Number: BC014913\nGene Symbol: SYTL4\nGene ID (NCBI): 94121\nRRID: AB_2877828\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96C24\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868974174377,"sku":"12128-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12128-1-ap","provider":"Iright","version":"1.0","type":"link"}