{"product_id":"proteintech-12131-1-ap","title":"Proteintech, 12131-1-AP, CREM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CREM (12131-1-AP) by Proteintech is a Polyclonal antibody targeting CREM in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12131-1-AP targets CREM in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue, mouse thymus tissue,  rat thymus tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCyclic AMP-responsive element modulator (CREM) is a transcription factor highly expressed in the post-meiotic germ cells of the testis. Its pivotal role is to regulate the expression of several germ cell-specific genes, a crucial function as demonstrated by the severe phenotype of mice whose CREM gene was mutated by homologous recombination. CREM-deficient male animals are sterile and display a ten-fold increase in the apoptosis of germ cells. Recent results have shown that CREM needs a tissue-specific co-activator, ACT (activator of CREM in testis) to elicit its regulatory function in testis (PMID: 10824972). Also, CREM is a crucial regulator of NK cell function. CREM exerts its regulatory functions through epigenetic reprogramming of CAR-NK cells (PMID: 40468083).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2775 Product name: Recombinant human CREM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-137 aa of BC017117 Sequence: MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL Predict reactive species\nFull Name: cAMP responsive element modulator\nCalculated Molecular Weight: 332 aa, 36 kDa\nObserved Molecular Weight: 36 kDa\nGenBank Accession Number: BC017117\nGene Symbol: CREM\nGene ID (NCBI): 1390\nRRID: AB_2084260\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q03060\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964737193,"sku":"12131-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12131-1-ap","provider":"Iright","version":"1.0","type":"link"}