{"product_id":"proteintech-12142-1-ap","title":"Proteintech, 12142-1-AP, OIP5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OIP5 (12142-1-AP) by Proteintech is a Polyclonal antibody targeting OIP5 in WB, IP, ELISA applications with reactivity to human samples\n12142-1-AP targets OIP5 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, Jurkat cells\nPositive IP detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOIP5 is also known as Mis18β. Vertebrates possess two Mis18 paralogs, Mis18α and Mis18β. Mis18 has been previously shown to affect histone modifications and the methylation status of underlying chromatin . Eliminating histone methylation within the alpha satellite DNA repeats of a human artificial chromosome alters the recruitment of HJURP .The Mis18core complex was originally characterized as an oligomer with a proposed 2:2 stoichiometry of Mis18α and Mis18β, but additional work demonstrated a 4:2 Mis18α:Mis18β hexamer. (PMID: 31492860, PMID: 26942680)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2790 Product name: Recombinant human OIP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC015050 Sequence: MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN Predict reactive species\nFull Name: Opa interacting protein 5\nCalculated Molecular Weight: 229 aa, 25 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC015050\nGene Symbol: OIP5\nGene ID (NCBI): 11339\nRRID: AB_2157076\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O43482\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868913553577,"sku":"12142-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12142-1-ap","provider":"Iright","version":"1.0","type":"link"}