{"product_id":"proteintech-12154-1-ap","title":"Proteintech, 12154-1-AP, LMBR1L Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LMBR1L (12154-1-AP) by Proteintech is a Polyclonal antibody targeting LMBR1L in WB, IP, ELISA applications with reactivity to human,  mouse,  rat samples\n12154-1-AP targets LMBR1L in WB, IP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue,  A549 cells,  HepG2 cells,  mouse liver tissue,  rat testis tissue\nPositive IP detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLMBR1L, also known as LIMR (lipocalin-1-interacting membrane receptor), interacts with lipocalin-1 (Lcn-1), a lipocalin member produced by a number of secretoric glands and tissues and known to bind a variety of lipophilic compounds. LMBR1L is a 489-amino acid protein with a predicted molecular mass of 55 kD and 9 putative transmembrane helices. LMBR1L has been shown to mediate cellular uptake of LMBR1L, thus it is characterized as a endocytic receptor (PMID: 11287427; 12591932). Alternatively spliced transcript variants encoding different isoforms have been described.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2787 Product name: Recombinant human LMBR1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 219-490 aa of BC015015 Sequence: RMFSVTGKLLVKPRLLEDLEEQLYCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQTQRVLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAIHILELLIDEAAMPRGMQGTSLGQVSFSKLGSFGAVIQVVLIFYLMVSSVVGFYSSPLFRSLRPRWHDTAMTQIIGNCVCLLVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAAVRAELIRAFGLDRLPLPVSGFPQASRKTQHQ Predict reactive species\nFull Name: limb region 1 homolog (mouse)-like\nCalculated Molecular Weight: 489 aa, 55 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC015015\nGene Symbol: LMBR1L\nGene ID (NCBI): 55716\nRRID: AB_2136130\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6UX01\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887705149609,"sku":"12154-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12154-1-ap","provider":"Iright","version":"1.0","type":"link"}