{"product_id":"proteintech-12170-1-ap","title":"Proteintech, 12170-1-AP, RTF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RTF1 (12170-1-AP) by Proteintech is a Polyclonal antibody targeting RTF1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12170-1-AP targets RTF1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Calu-1 cells, HL-60 cells,  mouse brain tissue,  rat brain tissue,  HeLa cells,  Jurkat cells,  MCF-7 cells,  NIH\/3T3 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRTF1 (RNA polymerase-associated protein RTF1 homolog) is a multifunctional component of the Paf1 complex that regulates gene expression by directing cotranscriptional histone modification (PMID: 17576814). RTF1 is essential for global methylation of H3-Lys4 and H3-Lys79, but not H3-Lys36 (PMID: 12876293).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2812 Product name: Recombinant human RTF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-307 aa of BC015052 Sequence: MKKQANKTASSGSSDKDSSAESSAPEEGEVSDSDSNSSSSSSDSDSSSEDEEFHDGYGEDLMGDEEDRARLEQMTEKEREQELFNRIEKREVLKRRFEIKKKLKTAKKKEKKEKKKKQEEEQEKKKLTQIQESQVTSHNKERRSKRDEKLDKKSQAMEELKAEREKRKNRTAELLAKKQPLKTSEVYSDDEEEEEDDKSSEKSDRSSRTSSSDEEEEKEEIPPKSQPVSLPEELNRVRLSRHKLERWCHMPFFAKTVTGCFVRIGIGNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGN Predict reactive species\nFull Name: Rtf1, Paf1\/RNA polymerase II complex component, homolog (S. cerevisiae)\nCalculated Molecular Weight: 585aa,67 kDa; 710aa,80 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC015052\nGene Symbol: RTF1\nGene ID (NCBI): 23168\nRRID: AB_2180931\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92541\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869009793193,"sku":"12170-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12170-1-ap","provider":"Iright","version":"1.0","type":"link"}