{"product_id":"proteintech-12178-1-ap","title":"Proteintech, 12178-1-AP, SMNDC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMNDC1 (12178-1-AP) by Proteintech is a Polyclonal antibody targeting SMNDC1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12178-1-AP targets SMNDC1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, human heart tissue,  human lung tissue,  human liver tissue,  mouse skeletal muscle tissue,  rat heart tissue\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSurvival motor neuron domain-containing protein 1 (SMNDC1), also known as survival of motor neuron-related-splicing factor 30 (SPF30) or SMN-related protein (SMNR), is a constituent of the spliceosome complex that plays an essential role in spliceosome assembly by recruiting U4\/U5\/U6 tri-snRNP to the pre-spliceosomal complex (PMID: 9817934; 11331595; 30904945). Both SMNDC1 and SMN1 contain a highly conserved central Tudor domain which functions as a protein-protein interaction surface and mediates binding to the spliceosomal Sm proteins (PMID: 11331595).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2822 Product name: Recombinant human SMNDC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-238 aa of BC011234 Sequence: MSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ Predict reactive species\nFull Name: survival motor neuron domain containing 1\nCalculated Molecular Weight: 238 aa, 27 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC011234\nGene Symbol: SMNDC1\nGene ID (NCBI): 10285\nRRID: AB_2239665\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75940\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887809941673,"sku":"12178-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12178-1-ap","provider":"Iright","version":"1.0","type":"link"}