{"product_id":"proteintech-12179-1-ap","title":"Proteintech, 12179-1-AP, MT3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MT3 (12179-1-AP) by Proteintech is a Polyclonal antibody targeting MT3 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n12179-1-AP targets MT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse brain tissue, human brain tissue,  human testis tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMT3(Metallothionein-3) is also names as GIF(Growth inhibitory factor),GIFB inhibits N-glycosylation of IgE-binding factors and that unglycosylated IgE-binding factors selectively suppressed IgE synthesis.The major cell source of GIF is antigen-specific suppressor T(Ts)cell(PMID:10967025).The molecular size of GIF from T cells is 15 kDa, while GIF from macrophages consisted of 40-and 15-kDa molecules(PMID:2417235).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2823 Product name: Recombinant human MT3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC013081 Sequence: MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ Predict reactive species\nFull Name: metallothionein 3\nCalculated Molecular Weight: 68 aa, 7 kDa\nGenBank Accession Number: BC013081\nGene Symbol: MT3\nGene ID (NCBI): 4504\nRRID: AB_2146645\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P25713\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869562327209,"sku":"12179-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12179-1-ap","provider":"Iright","version":"1.0","type":"link"}