{"product_id":"proteintech-12229-1-ap","title":"Proteintech, 12229-1-AP, NDP52 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NDP52 (12229-1-AP) by Proteintech is a Polyclonal antibody targeting NDP52 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12229-1-AP targets NDP52 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human placenta tissue,  Jurkat cells,  mouse skeletal muscle tissue,  rat skeletal muscle tissue,  A549 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovary cancer tissue, human ovary tumor tissue,  human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNDP52, also named as CALCOCO2, is an autophagy receptor. It plays a role in ruffle formation and actin cytoskeleton organization. Mouse\/Rat NDP52 has some isoforms with MW 28-40 kDa and 67 kDa. Human NDP52 has some isoforms with MW 43-47 kDa and 52-55 kDa,\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2866 Product name: Recombinant human CALCOCO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-283 aa of BC015893 Sequence: MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQGEVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELLQLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQKKLE Predict reactive species\nFull Name: calcium binding and coiled-coil domain 2\nCalculated Molecular Weight: 446 aa, 52 kDa\nObserved Molecular Weight: 52 kDa\nGenBank Accession Number: BC015893\nGene Symbol: NDP52\nGene ID (NCBI): 10241\nRRID: AB_11182600\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13137\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868836647081,"sku":"12229-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12229-1-ap","provider":"Iright","version":"1.0","type":"link"}