{"product_id":"proteintech-12290-1-ap","title":"Proteintech, 12290-1-AP, RHOF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RHOF (12290-1-AP) by Proteintech is a Polyclonal antibody targeting RHOF in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12290-1-AP targets RHOF in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  human brain tissue,  COLO 320 cells,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human colon cancer tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2943 Product name: Recombinant human RHOF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-170 aa of BC018208 Sequence: MDAPGALAQTAAPGPGRKELKIVIVGDGGCGKTSLLMVYSQGSFPEHYAPSVFEKYTASVTVGSKEVTLNLYDTAGQEDYDRLRPLSYQNTHLVLICYDVMNPTSYDNVLIKWFPEVTHFCRGIPMVLIGCKTDLRKDKEQLRKLRAAQLEPITYMQVGRGQDPGAQPWL Predict reactive species\nFull Name: ras homolog gene family, member F (in filopodia)\nCalculated Molecular Weight: 211 aa, 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC018208\nGene Symbol: RHOF\nGene ID (NCBI): 54509\nRRID: AB_10644126\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9HBH0\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869008973993,"sku":"12290-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12290-1-ap","provider":"Iright","version":"1.0","type":"link"}