{"product_id":"proteintech-12292-1-ap","title":"Proteintech, 12292-1-AP, ALKBH3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALKBH3 (12292-1-AP) by Proteintech is a Polyclonal antibody targeting ALKBH3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12292-1-AP targets ALKBH3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse kidney tissue,  mouse heart tissue,  rat heart tissue\nPositive IHC detected in: human lung cancer tissue, human testis tissue,  human prostate cancer tissue,  human pancreas cancer tissue,  rat stomach tissue,  mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nALKBH3, also named as ABH3 and DEPC-1, is a dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). It has a strong preference for single-stranded. ALKBH3 is requires molecular oxygen, alpha-ketoglutarate and iron. This gene has some isoforms with MW 19-25 kDa and 33 kDa. It is possible that there is ubiquitination modification (PMID: 25944111).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2982 Product name: Recombinant human ALKBH3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 148-286 aa of BC015155 Sequence: MEPNPHWHPVLRTLKNRIEENTGHTFNSLLCNLYRNEKDSVDWHSDDEPSLGRCPIIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGATQADWQHRVPKEYHSREPRVNLTFRTVYPDPRGAPW Predict reactive species\nFull Name: alkB, alkylation repair homolog 3 (E. coli)\nCalculated Molecular Weight: 286 aa, 33 kDa\nObserved Molecular Weight: 22-25 kDa, 33kDa\nGenBank Accession Number: BC015155\nGene Symbol: ALKBH3\nGene ID (NCBI): 221120\nRRID: AB_11125161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96Q83\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868976173225,"sku":"12292-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12292-1-ap","provider":"Iright","version":"1.0","type":"link"}