{"product_id":"proteintech-12296-1-ap","title":"Proteintech, 12296-1-AP, SFXN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFXN1 (12296-1-AP) by Proteintech is a Polyclonal antibody targeting SFXN1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12296-1-AP targets SFXN1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, human brain tissue,  mouse liver tissue,  mouse brain tissue,  rat brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human breast cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSFXN1, the founding member of the SLC56 family, was identified by positional cloning of the mutation in the flexed-tail mouse model with sideroblastic anemia. SFXN1 was recently identified as a mitochondrial serine transporter essential for one-carbon (1C) metabolism, a process in which folate species are generated and used in biosynthetic pathways required for cell proliferation. In HEK293 cells, SFXN1 is the most abundant isoform among the SFXNs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2985 Product name: Recombinant human SFXN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC020517 Sequence: MILIGRMSAQVPMNMTITGCMMTFYRTTPAVLFWQWINQSFNAVVNYTNRSGDAPLTVNELGTAYVSATTGAVATALGLNALTKHVSPLIGRFVPFAAVAAANCINIPLMRQRELKVGIPVTDENGNRLGESANAAKQAITQVVVSRILMAAPGMAIPPFIMNTLEKKAFLKRFPWMSAPIQVGLVGFCLVFATPLCCALFPQKSSMSVTSLEAELQAKIQESHPELRRVYFNKGL Predict reactive species\nFull Name: sideroflexin 1\nCalculated Molecular Weight: 35.6 kDa\nObserved Molecular Weight: 30-35 kDa\nGenBank Accession Number: BC020517\nGene Symbol: SFXN1\nGene ID (NCBI): 94081\nRRID: AB_2185814\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H9B4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868908671145,"sku":"12296-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12296-1-ap","provider":"Iright","version":"1.0","type":"link"}