{"product_id":"proteintech-12300-1-ap","title":"Proteintech, 12300-1-AP, ITGB1BP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ITGB1BP1 (12300-1-AP) by Proteintech is a Polyclonal antibody targeting ITGB1BP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12300-1-AP targets ITGB1BP1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells, mouse thymus tissue,  human brain tissue\nPositive IP detected in: mouse thymus tissue\nPositive IHC detected in: human heart tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nITGB1BP1, also named as ICAP1, is a key regulator of the integrin-mediated cell-matrix interaction signaling by binding to the ITGB1 cytoplasmic tail. It plays a role in cell proliferation, differentiation, spreading, adhesion and migration in the context of mineralization and bone development and angiogenesis. ITGB1BP1 promotes transcriptional activity of the MYC promoter.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2945 Product name: Recombinant human ITGB1BP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8-200 aa of BC012264 Sequence: RHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLKLSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGVGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP Predict reactive species\nFull Name: integrin beta 1 binding protein 1\nCalculated Molecular Weight: 200 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC012264\nGene Symbol: ITGB1BP1\nGene ID (NCBI): 9270\nRRID: AB_10640896\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14713\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887687520425,"sku":"12300-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12300-1-ap","provider":"Iright","version":"1.0","type":"link"}