{"product_id":"proteintech-12306-1-ap","title":"Proteintech, 12306-1-AP, ZFP36L1\/2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZFP36L1\/2 (12306-1-AP) by Proteintech is a Polyclonal antibody targeting ZFP36L1\/2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n12306-1-AP targets ZFP36L1\/2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: U-937 cells, 3T3-L1 cells,  RAW 264.7 cells,  HeLa cells\nPositive IHC detected in: rat ovary tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZFP36L1, also named as Butyrate response factor 1 or TPA-induced sequence 11b, is a 338 amino acid protein, which is phosphorylated by RPS6KA1 at Ser-334 upon phorbol 12-myristate 13-acetate (PMA) treatment. ZFP36 encodes tristetraprolin (TTP) the prototype of a small family of RBPs, called the ZFP36 family, that are characterised by highly conserved tandem CCCH zinc-finger RNA-binding domains [PMID: 10751406]. ZFP36 is a RBP that promotes RNA decay and negatively regulates the expression of the myogenic regulatory factor MyoD by binding to the 3'UTR of MyoD mRNA [PMID: 25815583]. Mouse satellite cells from Zfp36-deficient mice express increased amounts of MyoD and display impaired satellite activation, demonstrating a role for ZFP36 in the maintenance of quiescence [PMID: 25815583]. The functions of the ZFP36L1 and ZFP36L2 family members have not been evaluated in skeletal muscle stem cell fate, but have been shown to act redundantly to promote quiescence during lymphocyte development. ZFP36L1 has been implicated in the persistence of the marginal zone B lymphocyte population. ZFP36L1 exists three isoform through blasting on NCBI database and can be phosphorylated, so the range of the molecular weight of ZFP36L1 is about 40-50 kDa. (PMID: 26180518, PMID: 17030620). This antibody recognizes both ZFP36L1 and ZFP36L2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2952 Product name: Recombinant human ZFP36L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-338 aa of BC018340 Sequence: MTTTLVSATIFDLSEVLCKGNKMLNYSAPSAGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSRFRDRSFSEGGERLLPTQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGARDLSADRPRLQHSFSFAGFPSAAATAAATGLLDSPTSITPPPILSADDLLGSPTLPDGTNNPFAFSSQELASLFAPSMGLPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD Predict reactive species\nFull Name: zinc finger protein 36, C3H type-like 1\nCalculated Molecular Weight: 338 aa, 36 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC018340\nGene Symbol: ZFP36L1\nGene ID (NCBI): 677\nRRID: AB_2737443\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q07352\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868991508649,"sku":"12306-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12306-1-ap","provider":"Iright","version":"1.0","type":"link"}