{"product_id":"proteintech-12310-1-ap","title":"Proteintech, 12310-1-AP, HRPT2, CDC73 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HRPT2, CDC73 (12310-1-AP) by Proteintech is a Polyclonal antibody targeting HRPT2, CDC73 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12310-1-AP targets HRPT2, CDC73 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  HepG2 cells\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nParafibromin is a product of the hyperparathyroidism-jaw tumor syndrome gene HRPT2\/CDC73, a putative tumor suppressor gene recently implicated in the autosomal dominant hyperparathyroidism-jaw tumor familial cancer syndrome, sporadic parathyroid cancer, and a minority of families with isolated hyperparathyroidism (PMID: 15580289). Defects in CDC73 are causes of hyperparathyroidism type 1 (HRPT1) and hyperparathyroidism type 2 (HRPT2) as well as parathyroid carcinoma (PRTC) (PMID: 12434154). Tumor suppressor parafibromin to the transcription elongation and RNA processing pathway as a PAF1 complex- and RNA polymerase II-bound protein (PMID: 15923622). Besides, parafibromin is also involved in post-transcriptional control pathways (PMID: 16116486). Recent report has revealed that pathogenic mutation, such as CDC73 gene mutation, is able to affect histone monoubiquitination (PMID: 22021426).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2959 Product name: Recombinant human HRPT2; CDC73 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 109-409 aa of BC014351 Sequence: WRTRTTILQSTGKNFSKNIFAILQSVKAREEGRAPEQRPAPNAAPVDPTLRTKQPIPAAYNRYDQERFKGKEETEGFKIDTMGTYHGMTLKSVTEGASARKTQTPAAQPVPRPVSQARPPPNQKKGSRTPIIIIPAATTSLITMLNAKDLLQDLKFVPSDEKKKQGCQRENETLIQRRKDQMQPGGTAISVTVPYRVVDQPLKLMPQDWDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHLRF Predict reactive species\nFull Name: cell division cycle 73, Paf1\/RNA polymerase II complex component, homolog (S. cerevisiae)\nCalculated Molecular Weight: 531 aa, 61 kDa\nObserved Molecular Weight: 61 kDa\nGenBank Accession Number: BC014351\nGene Symbol: HRPT2\/CDC73\nGene ID (NCBI): 79577\nRRID: AB_2078388\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6P1J9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869695201449,"sku":"12310-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12310-1-ap","provider":"Iright","version":"1.0","type":"link"}