{"product_id":"proteintech-12316-1-ap","title":"Proteintech, 12316-1-AP, ANGPTL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ANGPTL2 (12316-1-AP) by Proteintech is a Polyclonal antibody targeting ANGPTL2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12316-1-AP targets ANGPTL2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: H9C2 cells, 3T3-L1 cells,  mouse spleen tissue,  mouse heart tissue,  mouse small intestine,  mouse testis tissue,  rat heart tissue\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: human colon cancer tissue, human heart tissue,  human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nANGPTL2 (angiopoietin-like 2), a member of the Angptl protein family, is predominantly secreted from adipose tissue and the heart. ANGPTL2 consists of an N-terminus with a conserved coiled-coil domain, two glycosylation sites and a C-terminus with a conserved fibrinogen-like domain. It is a key adipocyte-derived inflammatory mediator that links obesity to systemic INS resistance. ANGPTL2 may play an important role in the pathogenesis of diabetic glomerulopathy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2969 Product name: Recombinant human ANGPTL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 193-493 aa of BC012368 Sequence: QSEIIAQLEEHCQRVPSARPVPQPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPSSTDKPSGPWRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRNWETYKQGFGNIDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYKLRLGRYHGNAGDSFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEFRGGSYSLKKVVMMIRPNPNTFH Predict reactive species\nFull Name: angiopoietin-like 2\nCalculated Molecular Weight: 493 aa, 57 kDa\nObserved Molecular Weight: 57-64 kDa\nGenBank Accession Number: BC012368\nGene Symbol: ANGPTL2\nGene ID (NCBI): 23452\nRRID: AB_2226307\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UKU9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868880916649,"sku":"12316-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12316-1-ap","provider":"Iright","version":"1.0","type":"link"}