{"product_id":"proteintech-12320-1-ap","title":"Proteintech, 12320-1-AP, RAB3D Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB3D (12320-1-AP) by Proteintech is a Polyclonal antibody targeting RAB3D in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12320-1-AP targets RAB3D in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue,  A549 cells,  human cerebellum tissue,  human stomach tissue,  mouse spleen tissue,  mouse stomach tissue,  SW 1990 cells\nPositive IP detected in: SW 1990 cells\nPositive IHC detected in: human prostate cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2400\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab3D is a member of the Rab3 subfamily, which comprises four isoforms (Rab3A, Rab3B, Rab3C, and Rab3D). Rab3 proteins typically associate with secretory vesicles, including synaptic vesicles, and have been implicated in the control of regulated exocytosis. Rab3D is widely expressed in adipocytes, exocrine glands and several haematopoietic cells, where it localizes to secretory granules and vesicles.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, canine, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2973 Product name: Recombinant human RAB3D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC016471 Sequence: MASAGDTQAGPRDAADQNFDYMFKLLLIGNSSVGKTSFLFRYADDSFTPAFVSTVGIDFKVKTVYRHDKRIKLQIWDTAGQERYRTITTAYYRGAMGFLLMYDIANQESFAAVQDWATQIKTYSWDNAQVILVGNKCDLEDERVVPAEDGRRLADDLGFEFFEASAKENINVKQVFERLVDVICEKMNESLEPSSSSGSNGKGPAVGDAPAPQPSSCSC Predict reactive species\nFull Name: RAB3D, member RAS oncogene family\nCalculated Molecular Weight: 219 aa, 24 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC016471\nGene Symbol: RAB3D\nGene ID (NCBI): 9545\nRRID: AB_2177228\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95716\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868880425129,"sku":"12320-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12320-1-ap","provider":"Iright","version":"1.0","type":"link"}