{"product_id":"proteintech-12327-1-ap","title":"Proteintech, 12327-1-AP, TWSG1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TWSG1 (12327-1-AP) by Proteintech is a Polyclonal antibody targeting TWSG1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12327-1-AP targets TWSG1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, mouse cerebellum tissue\nPositive IHC detected in: mouse brain tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBone morphogenetic proteins (BMPs) are potent morphogens that are involved in cell fate determination, proliferation, apoptosis and adult tissue homeostasis. Twisted gastrulation (TWSG1) is a secreted BMP binding protein that modulates BMP ligand availability in the extracellular space. Several in vitro studies point toward an important role of TWSG1 in the regulation of the immune system (PMID: 21572028).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag2983 Product name: Recombinant human TWSG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 14-223 aa of BC020490 Sequence: LMFLTWLPESLSCNKALCASDVSKCLIQELCQCRPGEGNCSCCKECMLCLGALWDECCDCVGMCNPRNYSDTPPTSKSTVEELHEPIPSLFRALTEGDTQLNWNIVSFPVAEELSHHENLVSFLETVNQPHHQNVSVPSNNVHAPYSSDKEHMCTVVYFDDCMSIHQCKISCESMGASKYRWFHNACCECIGPECIDYGSKTVKCMNCMF Predict reactive species\nFull Name: twisted gastrulation homolog 1 (Drosophila)\nCalculated Molecular Weight: 223 aa, 25 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC020490\nGene Symbol: TWSG1\nGene ID (NCBI): 57045\nRRID: AB_2877845\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9GZX9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887911719081,"sku":"12327-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12327-1-ap","provider":"Iright","version":"1.0","type":"link"}