{"product_id":"proteintech-12329-1-ap","title":"Proteintech, 12329-1-AP, NUP98-NUP96 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUP98-NUP96 (12329-1-AP) by Proteintech is a Polyclonal antibody targeting NUP98-NUP96 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human samples\n12329-1-AP targets NUP98-NUP96 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, Jurkat cells,  HeLa cells,  K-562 cells,  MCF-7 cells\nPositive IP detected in: COLO 320 cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNup98-Nup96 (also known as Nup196, ADIR2 or ADAR2), encoded by NUP98 gene, is a component of the nuclear pore complex (NPC) . It is first synthesized as 186-198 kDa Nup98-Nup96 precursors and the precursors shortly undergo autoproteolysis to give rise to two nucleoporins, the amino-terminal Nup98 (Nup98-N) and carboxy-terminal Nup96 (Nup96-C). Both of Nup98 and Nup96 are localized to the nucleoplasmic side of the NPC. This antibody was raised against the carboxy-terminal region of Nup98-Nup96, it recognizes all Nup98-Nup96 proteins except Nup98-N. Since the autoproteolysis is very rapid this antibody usually detected 98-115 kDa Nup96 protein in multiple cell lines. It is notable that RNA-editing deaminase 1 (Gene ID: 104), also named ADAR2, is a different protein from Nup98-Nup96 (ADAR2).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3016 Product name: Recombinant human NUP98-NUP96 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1515-1817 aa of BC012906 Sequence: TADPLDYRLSWHLWEVLRALNYTHLSAQCEGVLQASYAGQLESEGLWEWAIFVLLHIDNSGIREKAVRELLTRHCQLLETPESWAKETFLTQKLRVPAKWIHEAKAVRAHMESDKHLEALCLFKAEHWNRCHKLIIRHLASDAIINENYDYLKGFLEDLAPPERSSLIQDWETSGLVYLDYIRVIEMLRHIQQVDCSGNDLEQLHIKVTSLCSRIEQIQCYSAKDRLAQSDMAKRVANLLRVVLSLHHPPDRTSDSTPDPQRVPLRLLAPHIGRLPMPEDYAMDELRSLTQSYLRELAVGSL Predict reactive species\nFull Name: nucleoporin 98kDa\nCalculated Molecular Weight: 98 kDa\nObserved Molecular Weight: 105 kDa\nGenBank Accession Number: BC012906\nGene Symbol: NUP98\nGene ID (NCBI): 4928\nRRID: AB_10973678\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P52948\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868985675945,"sku":"12329-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12329-1-ap","provider":"Iright","version":"1.0","type":"link"}