{"product_id":"proteintech-12350-1-ap","title":"Proteintech, 12350-1-AP, LIMK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIMK2 (12350-1-AP) by Proteintech is a Polyclonal antibody targeting LIMK2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12350-1-AP targets LIMK2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe family of LIM kinase (LIMK) includes two similar proteins, LIMK1 and LIMK2, that share overall identity of 53% with 75%, 55%, and 42% amino acid identity in the LIM, kinase, and PDZ domains, respectively. LIMK2 regulates actin cytoskeletal reorganization through phosphorylating and inactivating cofilin, an actin-depolymerizing factor of actin filaments. It also may associate with gamma-tubulin and play a role in mitotic spindle assembly. High levels of LIMK2 are evident in uterus, thymus, and spleen whereas lower levels are observed in brain, heart, liver, stomach, skeletal muscle, and testes according to the results of western blotting(PMID:16399995). It has 3 isoforms produced by alternative splicing of the molecular weight of 70-78 kDa. It can be detected a band of 47 kDa or 50-55 kDa in the testes because the antibody is recognizing the testis-specific variant of LIMK2 and the this difference could be due to species variation(PMID:17928627).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3011 Product name: Recombinant human LIMK2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 379-686 aa of BC013051 Sequence: KLNLLTEYIEGGTLKDFLRSMDPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKRAPMEKATTKKRTLRKNDRKKRYTVVGNPYWMAPEMLNGKSYDETVDIFSFGIVLCEIIGQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCRLEPESRAPPGAAGEGPGCADDEGPVRRQGKVTIKYDPKELRKHLNLEEWILEQLTRLYDCQEEEISELEIDVDELLDMESDDAWASRVKELLVDCYKPTEAFISGLLDKIRAMQKLSTPQKK Predict reactive species\nFull Name: LIM domain kinase 2\nCalculated Molecular Weight: 686 aa, 78 kDa\nObserved Molecular Weight: 70-80 kDa\nGenBank Accession Number: BC013051\nGene Symbol: LIMK2\nGene ID (NCBI): 3985\nRRID: AB_2137094\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P53671\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868942356649,"sku":"12350-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12350-1-ap","provider":"Iright","version":"1.0","type":"link"}