{"product_id":"proteintech-12379-1-ap","title":"Proteintech, 12379-1-AP, SF3B14 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SF3B14 (12379-1-AP) by Proteintech is a Polyclonal antibody targeting SF3B14 in WB, ELISA applications with reactivity to human, mouse, rat samples\n12379-1-AP targets SF3B14 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPre-mRNA splicing by the human spliceosome requires the sequential recognition by RNA and protein factors of the 5′ and 3′ splice sites,the branch region and the polypyrimidine tract. This sequence is characterized by the stepwise association of the U1, U2, and U4\/U5\/U6 snRNP particles [PMID:9476892]. Human p14 (SF3b14), a component of the spliceosomal U2 snRNP, interacts directly with the pre-mRNA branch adenosine within the context of the bulged duplex formed between the pre-mRNA branch region and U2 snRNA. This association occurs early in spliceosome assembly and persists within the fully assembled spliceosome [PMID:21062891].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3045 Product name: Recombinant human SF3B14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC015463 Sequence: MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK Predict reactive species\nFull Name: splicing factor 3B, 14 kDa subunit\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC015463\nGene Symbol: SF3B14\nGene ID (NCBI): 51639\nRRID: AB_2186517\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y3B4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869498134697,"sku":"12379-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12379-1-ap","provider":"Iright","version":"1.0","type":"link"}