{"product_id":"proteintech-12381-1-ap","title":"Proteintech, 12381-1-AP, 14-3-3 GAMMA-Specific Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe 14-3-3 GAMMA-Specific (12381-1-AP) by Proteintech is a Polyclonal antibody targeting 14-3-3 GAMMA-Specific in WB, IHC, IF\/ICC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat, canine samples\n12381-1-AP targets 14-3-3 GAMMA-Specific in WB, IHC, IF\/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse IMCD3 cells (RNAi), A431 cells,  K-562 cells,  NIH\/3T3 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF\/ICC detected in: MDCK cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\n14-3-3 gamma (also known as YWHAG) is a member of 14-3-3 proteins which were the first phosphoserine\/phosphothreonine-binding proteins to be discovered. 14-3-3 family members interact with a wide spectrum of proteins and possess diverse functions. Mammals express seven distinct 14-3-3 isoforms (gamma, epsilon, beta, zeta, sigma, theta, tau) that form multiple homo- and hetero- dimmers. 14-3-3 proteins display the highest expression levels in the brain, and have been implicated in several neurodegenerative diseases, including Alzheimer's disease and amyotrophic lateral sclerosis. This antibody specifically recognizes gamma isoform of 14-3-3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, canine\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3047 Product name: Recombinant human 14 3 3GAMMA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-247 aa of BC020963 Sequence: MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN Predict reactive species\nFull Name: tyrosine 3-monooxygenase\/tryptophan 5-monooxygenase activation protein, gamma polypeptide\nCalculated Molecular Weight: 247 aa, 28 kDa\nObserved Molecular Weight: 28-33 kDa\nGenBank Accession Number: BC020963\nGene Symbol: 14-3-3 gamma\nGene ID (NCBI): 7532\nRRID: AB_2217937\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P61981\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868938424489,"sku":"12381-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12381-1-ap","provider":"Iright","version":"1.0","type":"link"}