{"product_id":"proteintech-12417-1-ap","title":"Proteintech, 12417-1-AP, OSBPL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OSBPL3 (12417-1-AP) by Proteintech is a Polyclonal antibody targeting OSBPL3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n12417-1-AP targets OSBPL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, K-562 cells,  HeLa cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe oxysterol-binding protein-like (OSBPL) protein family includes nine members namely OSBPL2, OSBPL3, OSBPL5, OSBPL6, OSBPL7, OSBPL8, OSBPL9, OSBPL10, and OSBPL11. The OSBPL family proteins (OSBPLs) are located at the membrane to exchange molecules or signals between organelles and function as a necessary transporter. In addition to lipid transport, the OSBPLs are involved in the regulation of the actin cytoskeleton, cell polarity, and cell. Recently, the role of OSBPLs in cancer development has been gradually revealed. Upregulation of OSBPL3 could promote colorectal cancer. (PMID: 36918840)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3044 Product name: Recombinant human OSBPL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC017731 Sequence: MMSDEKNLGVSQKLVSPSRSTSSCSSKQGSRQDSWEVVEGLRGEMNYTQEPPVQKGFLLKKRKWPLKGWHKRFFYLDKGILKYAKSQTDIEREKLHGCIDVGLSVMSVKKSSKCIDLDTEEHIYHLKVKSEEVFDEWVSKLRHHRMYRQNEIAMFPHEVNHFFSGSTITDSSSGVFDSISSRKRSSISKQNLFQTGSNVSFSCGGETRVPLWLQSSEDMEKCSKDLAHCHAYLVEMSQLLQSMDVLHRTYSAPAINAIQGGSFESPKKEKRSHRRWRSRAIGKDAKGTLQVPKPFSGPVRLHSSNPNLSTLDFGEEKNYSDGSETSSEFSKMQEDLCHIAHKVYFTLRSA Predict reactive species\nFull Name: oxysterol binding protein-like 3\nCalculated Molecular Weight: 887 aa, 101 kDa\nObserved Molecular Weight: 95-110 kDa\nGenBank Accession Number: BC017731\nGene Symbol: OSBPL3\nGene ID (NCBI): 26031\nRRID: AB_2156103\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H4L5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869478736041,"sku":"12417-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12417-1-ap","provider":"Iright","version":"1.0","type":"link"}