{"product_id":"proteintech-12418-1-ap","title":"Proteintech, 12418-1-AP, TEAD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TEAD4 (12418-1-AP) by Proteintech is a Polyclonal antibody targeting TEAD4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n12418-1-AP targets TEAD4 in WB, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BGC-823 cells, HepG2 cells,  MCF-7 cells,  MDA-MB-231 cells,  L02 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTEAD4 belongs to a protein family that share the TEA\/ATTS domain. The transcriptional activity of TEAD4 required several regions of the proteins , a TBP-associated factor and a limiting transcriptional intermediary facotrs. TEAD4 also preforms an essential role in the Hippo signaling pathway. TEAD4 regulates gene expression of YAP1 and WWTR1\/TAZ, thus mediating cell proliferation, migration and epithelial mesenchymal transition induction. The calculated molecular weight of TEAD4 is 48 kDa, but molecular weight of TEAD4 is detected about 50-55 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3059 Product name: Recombinant human TEAD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 135-434 aa of BC015497 Sequence: SAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE Predict reactive species\nFull Name: TEA domain family member 4\nCalculated Molecular Weight: 434 aa, 48 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC015497\nGene Symbol: TEAD4\nGene ID (NCBI): 7004\nRRID: AB_2203074\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15561\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868855914665,"sku":"12418-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12418-1-ap","provider":"Iright","version":"1.0","type":"link"}