{"product_id":"proteintech-12423-1-ap","title":"Proteintech, 12423-1-AP, SLC20A1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC20A1 (12423-1-AP) by Proteintech is a Polyclonal antibody targeting SLC20A1 in WB, IHC, IP, ELISA applications with reactivity to human samples\n12423-1-AP targets SLC20A1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  human kidney tissue,  Jurkat cells,  K-562 cells,  unboiled HEK-293 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human liver tissue, human breast cancer tissue,  human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC20A1 (also known as PiT1) is a high-affinity sodium-dependent phosphate (Pi) import protein. It is widely expressed and plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions. SLC20A1 is involved in cell proliferation, tumor growth and cell signaling independently of its transport function. SLC20A1 also functions as a retroviral receptor, causing human cells to be susceptible to infection by gibbon ape leukemia virus, simian sarcoma-associated virus, feline leukemia virus subgroup B, and 10A1 murine leukemia virus.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3084 Product name: Recombinant human SLC20A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 249-570 aa of BC019944 Sequence: FVCPRMKRKIEREIKCSPSESPLMEKKNSLKEDHEETKLSVGDIENKHPVSEVGPATVPLQAVVEERTVSFKLGDLEEAPERERLPSVDLKEETSIDSTVNGAVQLPNGNLVQFSQAVSNQINSSGHYQYHTVHKDSGLYKELLHKLHLAKVGDCMGDSGDKPLRRNNSYTSYTMAICGMPLDSFRAKEGEQKGEEMEKLTWPNADSKKRIRMDSYTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVSLLFQFLQILTACFGSFAHGGNDVSNAIGPLVALYLVYDTGDVSSKVATPIWLLLYGGV Predict reactive species\nFull Name: solute carrier family 20 (phosphate transporter), member 1\nCalculated Molecular Weight: 679 aa, 74 kDa\nObserved Molecular Weight: 85 kDa\nGenBank Accession Number: BC019944\nGene Symbol: SLC20A1\nGene ID (NCBI): 6574\nRRID: AB_2286212\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8WUM9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868883013801,"sku":"12423-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12423-1-ap","provider":"Iright","version":"1.0","type":"link"}