{"product_id":"proteintech-12427-1-ap","title":"Proteintech, 12427-1-AP, CDC42SE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CDC42SE1 (12427-1-AP) by Proteintech is a Polyclonal antibody targeting CDC42SE1 in IHC, ELISA applications with reactivity to human samples\n12427-1-AP targets CDC42SE1 in IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCDC42SE1, also known as SPEC1, is a small effector protein of 9 kDa. CDC42SE1 consists of 79 amino acids, including a conserved CRIB domain, 2 conserved cysteines at the N-terminus, and a basic amino acid before the CRIB domain. CDC42SE1 has been shown to inhibit CDC42-induced JNK activity and cell morphological changes in COS1 cells (PMID: 23957315).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3098 Product name: Recombinant human CDC42SE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC012796 Sequence: MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL Predict reactive species\nFull Name: CDC42 small effector 1\nCalculated Molecular Weight: 79 aa, 9 kDa\nGenBank Accession Number: BC012796\nGene Symbol: CDC42SE1\nGene ID (NCBI): 56882\nRRID: AB_3669138\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRR8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886389940393,"sku":"12427-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12427-1-ap","provider":"Iright","version":"1.0","type":"link"}