{"product_id":"proteintech-12434-1-ap","title":"Proteintech, 12434-1-AP, STAM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe STAM (12434-1-AP) by Proteintech is a Polyclonal antibody targeting STAM in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n12434-1-AP targets STAM in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, Multi-cells,  mouse brain tissue,  Y79 cells,  Jurkat cells,  K-562 cells,  MCF-7 cells,  PC-3 cells,  Raji cells,  SKOV-3 cells,  C2C12 cells\nPositive IP detected in: PC-3 cells\nPositive IHC detected in: human testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTAM, also named as STAM1, belongs to the STAM family. It is involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. STAM may also play a role in T-cell development. It is involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs). Together with HRS, STAM forms ESCRT-0. STAM was originally identified as an adaptor protein involved in cytokine signaling.(PMID:20505072)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag3112 Product name: Recombinant human STAM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 54-403 aa of BC030586 Sequence: VNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTAYLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPGSGPTIRKPSPS Predict reactive species\nFull Name: signal transducing adaptor molecule (SH3 domain and ITAM motif) 1\nCalculated Molecular Weight: 59 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC030586\nGene Symbol: STAM\nGene ID (NCBI): 8027\nRRID: AB_2199965\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92783\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868875346089,"sku":"12434-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-12434-1-ap","provider":"Iright","version":"1.0","type":"link"}